PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA5G00149
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 355aa    MW: 39938 Da    PI: 5.7652
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA5G00149genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++ +G g W+ I+++ g++R++k+c++rw +yl
        AA5G00149 14 KGAWTAEEDKKLISYIHDHGEGGWRDIPAKAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.39.8e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
        AA5G00149  67 RGEFSFEEEQIIIMLHASRGNK-WSVIARHLP-RRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.121965IPR017930Myb domain
SuperFamilySSF466891.61E-2811108IPR009057Homeodomain-like
SMARTSM007171.9E-141363IPR001005SANT/Myb domain
PfamPF002491.8E-161461IPR001005SANT/Myb domain
CDDcd001675.41E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.92666116IPR017930Myb domain
SMARTSM007171.8E-1466114IPR001005SANT/Myb domain
PfamPF002492.7E-1367112IPR001005SANT/Myb domain
CDDcd001671.80E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009625Biological Processresponse to insect
GO:0009682Biological Processinduced systemic resistance
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MSRKPCCTGE GLKKGAWTAE EDKKLISYIH DHGEGGWRDI PAKAGLKRCG KSCRLRWTNY  60
LKPEIKRGEF SFEEEQIIIM LHASRGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLIDQG  120
IDPVTHKPLD SSNPPTPHES SDSQNAPGFE SRDYSRSSSM SSLSRPPSSE NINNDEMSNQ  180
KGSLSCKKHF GKSNSTSRLL NKVASKATSM KGILSASMEG SLSSSTLSNI SFNSDISKHI  240
SNTEDDNSNV SPTNFDEYYP LFQSTLYPEH EINATPDNFG MIGEFDDLSN ILEKLGHEDN  300
NTNVGYGCDF LMSDVSSTSV DDQENMIENN NGWSNYLLDN NEFIYEADSL QNHFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200950.11e-161transcription factor MYB28
SwissprotQ9SPG21e-163MYB28_ARATH; Transcription factor MYB28
TrEMBLD7MV181e-159D7MV18_ARALL; Putative uncharacterized protein
STRINGAT5G61420.21e-160(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61420.21e-141myb domain protein 28